SCOPe 2.07: Domain d3mfgb_: 3mfg B:

Lineage for d3mfgb_ (3mfg B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)

8. Domain d3mfgb_: 3mfg B: [213224]
   Other proteins in same PDB: d3mfga1, d3mfga2
   automated match to d1h5bb_
   complexed with gol, so4

Details for d3mfgb_

PDB Entry: 3mfg, 2.37 Å

PDB Description: Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)

PDB Compounds: (B:) V_segment translation product

SCOPe Domain Sequences for d3mfgb_:

Sequence, based on SEQRES records:

>d3mfgb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvsqhpsrvivksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsnegskatyeqg
vekdkflinhasltlstltvtsahpedsgfyicsalagsgsstdtqyfgpgtrltvl

Sequence, based on observed residues (ATOM records):

>d3mfgb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvsqhpsrvivksgtsvkiecrsldfqattmfwyrqfpslmlmatsnegskatyeqgve
kdkflinhasltlstltvtsahpedsgfyicsalagdtqyfgpgtrltvl

Timeline for d3mfgb_:

• d3mfgb_ first appeared in SCOPe 2.03
  
• d3mfgb_ appears in SCOPe 2.06
  
• d3mfgb_ appears in the current release, SCOPe 2.08