Lineage for d3mfgb_ (3mfg B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2754280Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)
  8. 2756020Domain d3mfgb_: 3mfg B: [213224]
    Other proteins in same PDB: d3mfga1, d3mfga2
    automated match to d1h5bb_
    complexed with gol, so4

Details for d3mfgb_

PDB Entry: 3mfg (more details), 2.37 Å

PDB Description: Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
PDB Compounds: (B:) V_segment translation product

SCOPe Domain Sequences for d3mfgb_:

Sequence, based on SEQRES records: (download)

>d3mfgb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvsqhpsrvivksgtsvkiecrsldfqattmfwyrqfpkqslmlmatsnegskatyeqg
vekdkflinhasltlstltvtsahpedsgfyicsalagsgsstdtqyfgpgtrltvl

Sequence, based on observed residues (ATOM records): (download)

>d3mfgb_ b.1.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvsqhpsrvivksgtsvkiecrsldfqattmfwyrqfpslmlmatsnegskatyeqgve
kdkflinhasltlstltvtsahpedsgfyicsalagdtqyfgpgtrltvl

SCOPe Domain Coordinates for d3mfgb_:

Click to download the PDB-style file with coordinates for d3mfgb_.
(The format of our PDB-style files is described here.)

Timeline for d3mfgb_: