SCOPe 2.07: Domain d3mfga2: 3mfg A:94-194

Lineage for d3mfga2 (3mfg A:94-194)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)

6. Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)

7. Species Staphylococcus aureus [TaxId:158879] [224922] (1 PDB entry)

8. Domain d3mfga2: 3mfg A:94-194 [213223]
   Other proteins in same PDB: d3mfga1, d3mfgb_
   automated match to d2tssa2
   complexed with gol, so4

Details for d3mfga2

PDB Entry: 3mfg, 2.37 Å

PDB Description: Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)

PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d3mfga2:

Sequence; same for both SEQRES and ATOM records:

>d3mfga2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 158879]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

Timeline for d3mfga2:

• d3mfga2 first appeared in SCOPe 2.03
  
• d3mfga2 appears in SCOPe 2.06
  
• d3mfga2 appears in the current release, SCOPe 2.08