Lineage for d3mfga2 (3mfg A:94-194)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2934365Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2934366Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 2934542Protein Toxic shock syndrome toxin-1 (TSST-1) [54340] (2 species)
  7. 2934573Species Staphylococcus aureus [TaxId:158879] [224922] (1 PDB entry)
  8. 2934574Domain d3mfga2: 3mfg A:94-194 [213223]
    Other proteins in same PDB: d3mfga1, d3mfgb_
    automated match to d2tssa2
    complexed with gol, so4

Details for d3mfga2

PDB Entry: 3mfg (more details), 2.37 Å

PDB Description: Crystal structure of Toxic Shock Syndrome Toxin 1 (TSST-1) in complex with the human T cell receptor beta chain Vbeta2.1 (EP-8)
PDB Compounds: (A:) toxic shock syndrome toxin-1

SCOPe Domain Sequences for d3mfga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mfga2 d.15.6.1 (A:94-194) Toxic shock syndrome toxin-1 (TSST-1) {Staphylococcus aureus [TaxId: 158879]}
lptpielplkvkvhgkdsplkywpkfdkkqlaistldfeirhqltqihglyrssdktggy
wkitmndgstyqsdlskkfeyntekppinideiktieaein

SCOPe Domain Coordinates for d3mfga2:

Click to download the PDB-style file with coordinates for d3mfga2.
(The format of our PDB-style files is described here.)

Timeline for d3mfga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mfga1
View in 3D
Domains from other chains:
(mouse over for more information)
d3mfgb_