SCOPe 2.05: Domain d3mffa2: 3mff A:122-210

Lineage for d3mffa2 (3mff A:122-210)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d3mffa2: 3mff A:122-210 [213215]
   Other proteins in same PDB: d3mffa1, d3mffb1, d3mffc1, d3mffd1
   automated match to d1qrnd2
   complexed with arg, gol, ure

Details for d3mffa2

PDB Entry: 3mff, 2 Å

PDB Description: 1f1e8hu tcr

PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d3mffa2:

Sequence, based on SEQRES records:

>d3mffa2 b.1.1.2 (A:122-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdatvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d3mffa2 b.1.1.2 (A:122-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdskdsdvyitdatvldmrsmdfksnsavawsnk
sdfacanafnnsiipedtffps

Timeline for d3mffa2:

• d3mffa2 first appeared in SCOPe 2.03
  
• d3mffa2 appears in SCOPe 2.04
  
• d3mffa2 appears in SCOPe 2.06
  
• d3mffa2 appears in the current release, SCOPe 2.08