Class b: All beta proteins [48724] (176 folds) |
Fold b.7: C2 domain-like [49561] (5 superfamilies) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) |
Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins) |
Protein PapD [49586] (1 species) |
Species Escherichia coli [TaxId:562] [49587] (14 PDB entries) |
Domain d3me0a2: 3me0 A:125-216 [213213] Other proteins in same PDB: d3me0a1 automated match to d1pdka2 |
PDB Entry: 3me0 (more details), 2.03 Å
SCOPe Domain Sequences for d3me0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3me0a2 b.7.2.1 (A:125-216) PapD {Escherichia coli [TaxId: 562]} nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa nyntpylsyindyggrpvlsficngsrcsvkk
Timeline for d3me0a2: