Lineage for d3me0a2 (3me0 A:125-216)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2772794Fold b.7: C2 domain-like [49561] (5 superfamilies)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 2773151Superfamily b.7.2: Periplasmic chaperone C-domain [49584] (2 families) (S)
  5. 2773152Family b.7.2.1: Periplasmic chaperone C-domain [49585] (5 proteins)
  6. 2773205Protein PapD [49586] (1 species)
  7. 2773206Species Escherichia coli [TaxId:562] [49587] (15 PDB entries)
  8. 2773208Domain d3me0a2: 3me0 A:125-216 [213213]
    Other proteins in same PDB: d3me0a1
    automated match to d1pdka2

Details for d3me0a2

PDB Entry: 3me0 (more details), 2.03 Å

PDB Description: Structure of the E. coli chaperone PAPD in complex with the pilin domain of the PapGII adhesin
PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d3me0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3me0a2 b.7.2.1 (A:125-216) PapD {Escherichia coli [TaxId: 562]}
nevwqdqlilnkvsggyrienptpyyvtviglggsekqaeegefetvmlsprseqtvksa
nyntpylsyindyggrpvlsficngsrcsvkk

SCOPe Domain Coordinates for d3me0a2:

Click to download the PDB-style file with coordinates for d3me0a2.
(The format of our PDB-style files is described here.)

Timeline for d3me0a2:

2773208
d3me0a2 in context of chain
View in 3D
Domains from same chain:
(mouse over for more information)
d3me0a1