Lineage for d3me0a1 (3me0 A:1-124)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299054Superfamily b.1.11: PapD-like [49354] (3 families) (S)
    contains PP switch between strands D and C'
  5. 1299055Family b.1.11.1: Pilus chaperone [49355] (6 proteins)
    automatically mapped to Pfam PF00345
  6. 1299114Protein Pilus chaperone PapD, N-domain [49356] (1 species)
    consists of two domains of this fold; domain 2 has an additional strand at the C-terminus
  7. 1299115Species Escherichia coli [TaxId:562] [49357] (14 PDB entries)
  8. 1299117Domain d3me0a1: 3me0 A:1-124 [213212]
    Other proteins in same PDB: d3me0a2
    automated match to d1pdka1

Details for d3me0a1

PDB Entry: 3me0 (more details), 2.03 Å

PDB Description: Structure of the E. coli chaperone PAPD in complex with the pilin domain of the PapGII adhesin
PDB Compounds: (A:) chaperone protein papd

SCOPe Domain Sequences for d3me0a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3me0a1 b.1.11.1 (A:1-124) Pilus chaperone PapD, N-domain {Escherichia coli [TaxId: 562]}
avsldrtravfdgseksmtldisndnkqlpylaqawienenqekiitgpviatppvqrle
pgaksmvrlsttpdisklpqdreslfyfnlreipprsekanvlqialqtkiklfyrpaai
ktrp

SCOPe Domain Coordinates for d3me0a1:

Click to download the PDB-style file with coordinates for d3me0a1.
(The format of our PDB-style files is described here.)

Timeline for d3me0a1: