SCOP 1.69: Domain d1cz8y2: 1cz8 Y:124-224

Lineage for d1cz8y2 (1cz8 Y:124-224)

Root: SCOP 1.69
Class b: All beta proteins [48724] (144 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
Species Human (Homo sapiens) [TaxId:9606] [88575] (82 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1cz8y2: 1cz8 Y:124-224 [21321]
Other proteins in same PDB: d1cz8h1, d1cz8l1, d1cz8l2, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8x2, d1cz8y1
part of humanized Fab-12 neutralizing VEGF; affinity matured

Details for d1cz8y2

PDB Entry: 1cz8 (more details), 2.4 Å

PDB Description: vascular endothelial growth factor in complex with an affinity matured antibody

SCOP Domain Sequences for d1cz8y2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz8y2 b.1.1.2 (Y:124-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1cz8y2:

Click to download the PDB-style file with coordinates for d1cz8y2.
(The format of our PDB-style files is described here.)

Timeline for d1cz8y2: