Lineage for d1cz8y2 (1cz8 Y:124-224)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104591Species VEGF neutralizing Fab-12 (mouse), kappa L chain [49080] (2 PDB entries)
  8. 104599Domain d1cz8y2: 1cz8 Y:124-224 [21321]
    Other proteins in same PDB: d1cz8h1, d1cz8l1, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8y1

Details for d1cz8y2

PDB Entry: 1cz8 (more details), 2.4 Å

PDB Description: vascular endothelial growth factor in complex with an affinity matured antibody
PDB Compounds: (Y:)

SCOP Domain Sequences for d1cz8y2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz8y2 b.1.1.2 (Y:124-224) Immunoglobulin (constant domains of L and H chains) {VEGF neutralizing Fab-12 (mouse), kappa L chain}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

SCOP Domain Coordinates for d1cz8y2:

Click to download the PDB-style file with coordinates for d1cz8y2.
(The format of our PDB-style files is described here.)

Timeline for d1cz8y2: