SCOP 1.75: Domain d1cz8x2: 1cz8 X:108-213

Lineage for d1cz8x2 (1cz8 X:108-213)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88569] (132 PDB entries)
   SQ NA # humanized antibody
   Uniprot P01834 # KAC_HUMAN Ig kappa chain C region
   SQ P01834 # KAC_HUMAN Ig kappa chain C region.
   SQ NA # engineered antibody
   including humanized antibodies (chimeric proteins with human constant domains)
   SQ NA # humanized antibody ! Uniprot P01834 # KAC_HUMAN Ig kappa chain C region ! SQ P01834 # KAC_HUMAN Ig kappa chain C region. ! SQ NA # engineered antibody

8. Domain d1cz8x2: 1cz8 X:108-213 [21320]
   Other proteins in same PDB: d1cz8h1, d1cz8h2, d1cz8l1, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8y1, d1cz8y2
   part of humanized Fab-12 neutralizing VEGF; affinity matured
   complexed with so4; mutant

Details for d1cz8x2

PDB Entry: 1cz8, 2.4 Å

PDB Description: vascular endothelial growth factor in complex with an affinity matured antibody

PDB Compounds: (X:) light chain of neutralizing antibody

SCOP Domain Sequences for d1cz8x2:

Sequence; same for both SEQRES and ATOM records:

>d1cz8x2 b.1.1.2 (X:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d1cz8x2:

• d1cz8x2 first appeared (with stable ids) in SCOP 1.55
  
• d1cz8x2 appears in SCOP 1.73
  
• d1cz8x2 appears in SCOPe 2.01
  
• d1cz8x2 appears in the current release, SCOPe 2.07