Lineage for d1cz8x2 (1cz8 X:108-213)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 54147Species VEGF neutralizing Fab-12 (mouse), kappa L chain [49080] (2 PDB entries)
  8. 54154Domain d1cz8x2: 1cz8 X:108-213 [21320]
    Other proteins in same PDB: d1cz8h1, d1cz8l1, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8y1

Details for d1cz8x2

PDB Entry: 1cz8 (more details), 2.4 Å

PDB Description: vascular endothelial growth factor in complex with an affinity matured antibody

SCOP Domain Sequences for d1cz8x2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz8x2 b.1.1.2 (X:108-213) Immunoglobulin (constant domains of L and H chains) {VEGF neutralizing Fab-12 (mouse), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1cz8x2:

Click to download the PDB-style file with coordinates for d1cz8x2.
(The format of our PDB-style files is described here.)

Timeline for d1cz8x2: