Lineage for d3mchc_ (3mch C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890232Family c.57.1.0: automated matches [191349] (1 protein)
    not a true family
  6. 2890233Protein automated matches [190284] (9 species)
    not a true protein
  7. 2890275Species Thermus thermophilus HB8 [TaxId:300852] [225367] (2 PDB entries)
  8. 2890281Domain d3mchc_: 3mch C: [213197]
    automated match to d3k6af_
    complexed with edo

Details for d3mchc_

PDB Entry: 3mch (more details), 1.64 Å

PDB Description: Crystal structure of the molybdopterin biosynthesis enzyme MoaB (TTHA0341) from thermus theromophilus HB8
PDB Compounds: (C:) Molybdopterin biosynthesis enzyme, MoaB

SCOPe Domain Sequences for d3mchc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mchc_ c.57.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mfrvgiltvsdkgfrgerqdtthlairevlaggpfevaayelvpdeppmikkvlrlwadr
egldliltnggtglaprdrtpeatrelldrevpglaelmrlvglrktpmaalsrgvagvr
grtlilnlpgspkgaresleavlpvlphalslvtgkpwk

SCOPe Domain Coordinates for d3mchc_:

Click to download the PDB-style file with coordinates for d3mchc_.
(The format of our PDB-style files is described here.)

Timeline for d3mchc_: