SCOPe 2.05: Domain d3mcha_: 3mch A:

Lineage for d3mcha_ (3mch A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.0: automated matches [191349] (1 protein)
   not a true family

6. Protein automated matches [190284] (9 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [225367] (2 PDB entries)

8. Domain d3mcha_: 3mch A: [213195]
   automated match to d3k6af_
   complexed with edo

Details for d3mcha_

PDB Entry: 3mch, 1.64 Å

PDB Description: Crystal structure of the molybdopterin biosynthesis enzyme MoaB (TTHA0341) from thermus theromophilus HB8

PDB Compounds: (A:) Molybdopterin biosynthesis enzyme, MoaB

SCOPe Domain Sequences for d3mcha_:

Sequence; same for both SEQRES and ATOM records:

>d3mcha_ c.57.1.0 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mfrvgiltvsdkgfrgerqdtthlairevlaggpfevaayelvpdeppmikkvlrlwadr
egldliltnggtglaprdrtpeatrelldrevpglaelmrlvglrktpmaalsrgvagvr
grtlilnlpgspkgaresleavlpvlphalslvtgkpwk

Timeline for d3mcha_:

• d3mcha_ first appeared in SCOPe 2.03
  
• d3mcha_ appears in SCOPe 2.04
  
• d3mcha_ appears in SCOPe 2.06
  
• d3mcha_ appears in the current release, SCOPe 2.08