Lineage for d3mbza_ (3mbz A:)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1450060Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 1450061Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 1450937Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 1450938Protein automated matches [190857] (15 species)
    not a true protein
  7. 1450939Species Acinetobacter baumannii [TaxId:470] [194613] (18 PDB entries)
  8. 1450962Domain d3mbza_: 3mbz A: [213192]
    automated match to d1k38a_
    complexed with mxc, so4

Details for d3mbza_

PDB Entry: 3mbz (more details), 2.6 Å

PDB Description: OXA-24 beta-lactamase complex soaked with 10mM SA4-17 inhibitor for 15min
PDB Compounds: (A:) Betalactamase OXA24

SCOPe Domain Sequences for d3mbza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mbza_ e.3.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 470]}
hissqqhekaiksyfdeaqtqgviiikegknlstygnalarankeyvpastfkmlnalig
lenhkattneifkwdgkkrtypmwekdmtlgeamalsavpvyqelarrtglelmqkevkr
vnfgntnigtqvdnfwlvgplkitpvqevnfaddlahnrlpfkletqeevkkmllikevn
gskiyaksgwgmgvtpqvgwltgwveqangkkipfslnlemkegmsgsirneitykslen
lgii

SCOPe Domain Coordinates for d3mbza_:

Click to download the PDB-style file with coordinates for d3mbza_.
(The format of our PDB-style files is described here.)

Timeline for d3mbza_: