Lineage for d3mbta_ (3mbt A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2395396Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2395397Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2396500Family b.60.1.0: automated matches [191454] (1 protein)
    not a true family
  6. 2396501Protein automated matches [190698] (21 species)
    not a true protein
  7. 2396525Species Escherichia coli K-12 [TaxId:83333] [226033] (1 PDB entry)
  8. 2396526Domain d3mbta_: 3mbt A: [213186]
    automated match to d2hzqa_

Details for d3mbta_

PDB Entry: 3mbt (more details), 2.6 Å

PDB Description: Structure of monomeric Blc from E. coli
PDB Compounds: (A:) Outer membrane lipoprotein blc

SCOPe Domain Sequences for d3mbta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3mbta_ b.60.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
gvtvvnnfdakrylgtwyeiarfdhrferglekvtatyslrddgglnvinkgynpdrgmw
qqsegkayftgaptraalkvsffgpfyggynvialdreyrhalvsgpdrdylwilsrtpt
isdevkqemlavatregfdvskfiwvqqp

SCOPe Domain Coordinates for d3mbta_:

Click to download the PDB-style file with coordinates for d3mbta_.
(The format of our PDB-style files is described here.)

Timeline for d3mbta_: