SCOPe 2.05: Domain d3mbib1: 3mbi B:-1-155

Lineage for d3mbib1 (3mbi B:-1-155)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.0: automated matches [191528] (1 protein)
   not a true family

6. Protein automated matches [190891] (25 species)
   not a true protein

7. Species Thermoplasma volcanium [TaxId:50339] [226070] (3 PDB entries)

8. Domain d3mbib1: 3mbi B:-1-155 [213180]
   automated match to d1dkrb1
   complexed with adp, hsx, mg, po4

Details for d3mbib1

PDB Entry: 3mbi, 1.8 Å

PDB Description: crystal structure of the phosphoribosylpyrophosphate (prpp) synthetase from thermoplasma volcanium in complex with adp-mg2+ and ribose 5- phosphate

PDB Compounds: (B:) Ribose-phosphate pyrophosphokinase

SCOPe Domain Sequences for d3mbib1:

Sequence; same for both SEQRES and ATOM records:

>d3mbib1 c.61.1.0 (B:-1-155) automated matches {Thermoplasma volcanium [TaxId: 50339]}
sgmkiialrsslklaariaeelktepvmpderrfpdgelylrydedltghnifiignths
daevmemiltlsaiqdyrtksvniiapyygyarqhqrykngepissqilteiyssysnsi
atvdihdektlsyskvkfsdlhandaivryyknvdvd

Timeline for d3mbib1:

• d3mbib1 first appeared in SCOPe 2.03
  
• d3mbib1 appears in SCOPe 2.04
  
• d3mbib1 appears in SCOPe 2.06
  
• d3mbib1 appears in the current release, SCOPe 2.08