Lineage for d1cz8l2 (1cz8 L:108-213)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289615Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 289616Species Human (Homo sapiens) [TaxId:9606] [88569] (62 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 289654Domain d1cz8l2: 1cz8 L:108-213 [21318]
    Other proteins in same PDB: d1cz8h1, d1cz8h2, d1cz8l1, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8y1, d1cz8y2

Details for d1cz8l2

PDB Entry: 1cz8 (more details), 2.4 Å

PDB Description: vascular endothelial growth factor in complex with an affinity matured antibody

SCOP Domain Sequences for d1cz8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz8l2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1cz8l2:

Click to download the PDB-style file with coordinates for d1cz8l2.
(The format of our PDB-style files is described here.)

Timeline for d1cz8l2: