Lineage for d1cz8l2 (1cz8 L:108-213)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 protein domains)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9289Species VEGF neutralizing Fab-12 (mouse), kappa L chain [49080] (2 PDB entries)
  8. 9295Domain d1cz8l2: 1cz8 L:108-213 [21318]
    Other proteins in same PDB: d1cz8h1, d1cz8l1, d1cz8v_, d1cz8w_, d1cz8x1, d1cz8y1

Details for d1cz8l2

PDB Entry: 1cz8 (more details), 2.4 Å

PDB Description: vascular endothelial growth factor in complex with an affinity matured antibody

SCOP Domain Sequences for d1cz8l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cz8l2 b.1.1.2 (L:108-213) Immunoglobulin (constant domains of L and H chains) {VEGF neutralizing Fab-12 (mouse), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1cz8l2:

Click to download the PDB-style file with coordinates for d1cz8l2.
(The format of our PDB-style files is described here.)

Timeline for d1cz8l2: