Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.0: automated matches [191319] (1 protein) not a true family |
Protein automated matches [190115] (75 species) not a true protein |
Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [225868] (3 PDB entries) |
Domain d3mbda_: 3mbd A: [213176] automated match to d1xdmb1 complexed with cl, po4 |
PDB Entry: 3mbd (more details), 2 Å
SCOPe Domain Sequences for d3mbda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3mbda_ c.1.10.0 (A:) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} mdcdhllrlgmtakkilengkgilaadetpktlgrrfeklgitnteenrrkfreilfstk gieryiggvilnqetfeqtsgsgvpltellkkkgieigikldkglidykekekisvgled ldlrckssafkdatfakwrslfyfydgipsedcinencsilakyaiicqknglvpivepe vflegdysmkrsyevtrqilstlmkylnyelvyipgvlikasyvtsgqlsnekytpkkva tftlrallstipcgipgivflsgghgsedaigflnainmergcrtwslsfsfaraltdgv letwrgddsnieeaqkilletsfkacrgaegklwdq
Timeline for d3mbda_: