Lineage for d3maka2 (3mak A:86-209)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713957Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (17 PDB entries)
  8. 2713986Domain d3maka2: 3mak A:86-209 [213172]
    Other proteins in same PDB: d3maka1
    automated match to d1jlva1
    complexed with gsh

Details for d3maka2

PDB Entry: 3mak (more details), 1.8 Å

PDB Description: crystal structure of glutathione transferase dmgstd1 from drosophila melanogaster, in complex with glutathione
PDB Compounds: (A:) Glutathione S-transferase 1-1

SCOPe Domain Sequences for d3maka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3maka2 a.45.1.0 (A:86-209) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kcpkkravinqrlyfdmgtlyqsfanyyypqvfakapadpeafkkieaafeflntflegq
dyaagdsltvadialvatvstfevakfeiskyanvnrwyenakkvtpgweenwagclefk
kyfe

SCOPe Domain Coordinates for d3maka2:

Click to download the PDB-style file with coordinates for d3maka2.
(The format of our PDB-style files is described here.)

Timeline for d3maka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3maka1