![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
![]() | Protein automated matches [226831] (73 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (17 PDB entries) |
![]() | Domain d3maka2: 3mak A:86-209 [213172] Other proteins in same PDB: d3maka1 automated match to d1jlva1 complexed with gsh |
PDB Entry: 3mak (more details), 1.8 Å
SCOPe Domain Sequences for d3maka2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3maka2 a.45.1.0 (A:86-209) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} kcpkkravinqrlyfdmgtlyqsfanyyypqvfakapadpeafkkieaafeflntflegq dyaagdsltvadialvatvstfevakfeiskyanvnrwyenakkvtpgweenwagclefk kyfe
Timeline for d3maka2: