SCOP 1.73: Domain d1bj1k2: 1bj1 K:124-224

Lineage for d1bj1k2 (1bj1 K:124-224)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (150 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)

8. Domain d1bj1k2: 1bj1 K:124-224 [21317]
   Other proteins in same PDB: d1bj1h1, d1bj1j1, d1bj1j2, d1bj1k1, d1bj1l1, d1bj1l2, d1bj1v_, d1bj1w_
   part of humanized Fab-12 neutralizing VEGF
   complexed with so4

Details for d1bj1k2

PDB Entry: 1bj1, 2.4 Å

PDB Description: vascular endothelial growth factor in complex with a neutralizing antibody

PDB Compounds: (K:) fab fragment

SCOP Domain Sequences for d1bj1k2:

Sequence, based on SEQRES records:

>d1bj1k2 b.1.1.2 (K:124-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Sequence, based on observed residues (ATOM records):

>d1bj1k2 b.1.1.2 (K:124-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk

Timeline for d1bj1k2:

• d1bj1k2 first appeared (with stable ids) in SCOP 1.55
  
• d1bj1k2 appears in SCOP 1.71
  
• d1bj1k2 appears in SCOP 1.75
  
• d1bj1k2 appears in the current release, SCOPe 2.08