SCOPe 2.05: Domain d3ma3a_: 3ma3 A:

Lineage for d3ma3a_ (3ma3 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Proto-oncogene serine/threonine-protein kinase Pim-1 [118133] (1 species)
   OPK group(?); PIM subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118134] (68 PDB entries)
   Uniprot P11309 33-305 ! Uniprot P11309 32-308

8. Domain d3ma3a_: 3ma3 A: [213161]
   automated match to d2qkra_
   protein/RNA complex; complexed with 01i

Details for d3ma3a_

PDB Entry: 3ma3, 2.3 Å

PDB Description: crystal structure of human proto-oncogene serine threonine kinase (pim1) in complex with a consensus peptide and a naphtho-difuran ligand

PDB Compounds: (A:) Proto-oncogene serine/threonine-protein kinase Pim-1

SCOPe Domain Sequences for d3ma3a_:

Sequence, based on SEQRES records:

>d3ma3a_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
qyqvgpllgsggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllkkv
ssgfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavr
hchncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryh
ryhgrsaavwslgillydmvcgdipfehdeeiiggqvffrqrvssecqhlirwclalrps
drptfeeiqnhpwmqdvllpqetaeihlh

Sequence, based on observed residues (ATOM records):

>d3ma3a_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]}
qyqvgpllggfgsvysgirvsdnlpvaikhvekdrisdwgelpngtrvpmevvllkkvss
gfsgvirlldwferpdsfvlilerpepvqdlfdfitergalqeelarsffwqvleavrhc
hncgvlhrdikdenilidlnrgelklidfgsgallkdtvytdfdgtrvysppewiryhry
hgrsaavwslgillydmvcgdipfehdeeiiggqvffrqrvssecqhlirwclalrpsdr
ptfeeiqnhpwmqdvllpqetaeihlh

Timeline for d3ma3a_:

• d3ma3a_ first appeared in SCOPe 2.03
  
• d3ma3a_ appears in SCOPe 2.04
  
• d3ma3a_ appears in SCOPe 2.06
  
• d3ma3a_ appears in the current release, SCOPe 2.08