Lineage for d1bj1j2 (1bj1 J:108-213)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549708Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549757Domain d1bj1j2: 1bj1 J:108-213 [21316]
    Other proteins in same PDB: d1bj1h1, d1bj1h2, d1bj1j1, d1bj1k1, d1bj1k2, d1bj1l1, d1bj1v_, d1bj1w_
    part of humanized Fab-12 neutralizing VEGF
    complexed with so4

Details for d1bj1j2

PDB Entry: 1bj1 (more details), 2.4 Å

PDB Description: vascular endothelial growth factor in complex with a neutralizing antibody

SCOP Domain Sequences for d1bj1j2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bj1j2 b.1.1.2 (J:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1bj1j2:

Click to download the PDB-style file with coordinates for d1bj1j2.
(The format of our PDB-style files is described here.)

Timeline for d1bj1j2: