Lineage for d3m8tb_ (3m8t B:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1440053Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1440054Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1440055Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1440173Protein automated matches [190079] (7 species)
    not a true protein
  7. 1440197Species Bradyrhizobium japonicum [TaxId:224911] [226051] (2 PDB entries)
  8. 1440199Domain d3m8tb_: 3m8t B: [213158]
    automated match to d2gmna1
    complexed with 4nz, dms, fmt, zn

Details for d3m8tb_

PDB Entry: 3m8t (more details), 1.33 Å

PDB Description: crystal structure of the complex between class b3 beta-lactamase bjp-1 and 4-nitrobenzene-sulfonamide
PDB Compounds: (B:) 'Blr6230 protein

SCOPe Domain Sequences for d3m8tb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m8tb_ d.157.1.1 (B:) automated matches {Bradyrhizobium japonicum [TaxId: 224911]}
kkwtapfepfqlidniyyvgtdgiavyviktsqglilmdtampqstgmikdniaklgfkv
adiklilnthahldhtggfaeikketgaqlvagerdkplleggyypgdeknedlafpavk
vdravkegdrvtlgdttltahatpghspgctswemtvkdgkedrevlffcsgtvalnrlv
gqptyagivddyratfakakamkidvllgphpevygmqakraemkdgapnpfikpgelvt
yatslsedfdkqlakqtaalekk

SCOPe Domain Coordinates for d3m8tb_:

Click to download the PDB-style file with coordinates for d3m8tb_.
(The format of our PDB-style files is described here.)

Timeline for d3m8tb_: