SCOPe 2.07: Domain d3m8sa2: 3m8s A:423-832

Lineage for d3m8sa2 (3m8s A:423-832)

1. Root: SCOPe 2.07

2. Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)

3. Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
   divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members

4. Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families)
   "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain

5. Family e.8.1.1: DNA polymerase I [56673] (5 proteins)

6. Protein DNA polymerase I (Klenow fragment) [56674] (3 species)

7. Species Thermus aquaticus [TaxId:271] [56676] (29 PDB entries)

8. Domain d3m8sa2: 3m8s A:423-832 [213156]
   Other proteins in same PDB: d3m8sa1
   automated match to d1jxea2
   protein/DNA complex; complexed with 15p, act, gol, hxb, mg, peg

Details for d3m8sa2

PDB Entry: 3m8s, 2.2 Å

PDB Description: Crystal structure of the large fragment of DNA polymerase I from Thermus aquaticus in a closed ternary complex with trapped 4'-methylated dTTP

PDB Compounds: (A:) DNA polymerase I, thermostable

SCOPe Domain Sequences for d3m8sa2:

Sequence; same for both SEQRES and ATOM records:

>d3m8sa2 e.8.1.1 (A:423-832) DNA polymerase I (Klenow fragment) {Thermus aquaticus [TaxId: 271]}
eerllwlyreverplsavlahmeatgvrldvaylralslevaeeiarleaevfrlaghpf
nlnsrdqlervlfdelglpaigktektgkrstsaavlealreahpivekilqyreltklk
styidplpdlihprtgrlhtrfnqtatatgrlsssdpnlqnipvrtplgqrirrafiaee
gwllvaldysqielrvlahlsgdenlirvfqegrdihtetaswmfgvpreavdplmrraa
ktinfgvlygmsahrlsqelaipyeeaqafieryfqsfpkvrawiektleegrrrgyvet
lfgrrryvpdlearvksvreaaermafnmpvqgtaadlmklamvklfprleemgarmllq
vhdelvleapkeraeavarlakevmegvyplavplevevgigedwlsake

Timeline for d3m8sa2:

• d3m8sa2 first appeared in SCOPe 2.03
  
• d3m8sa2 appears in SCOPe 2.06
  
• d3m8sa2 appears in the current release, SCOPe 2.08