SCOPe 2.05: Domain d3m8oh2: 3m8o H:119-221

Lineage for d3m8oh2 (3m8o H:119-221)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3m8oh2: 3m8o H:119-221 [213150]
   Other proteins in same PDB: d3m8ol2
   automated match to d1mcph2
   complexed with cl, gol

Details for d3m8oh2

PDB Entry: 3m8o, 1.55 Å

PDB Description: Human IgA1 Fab fragment

PDB Compounds: (H:) Immunoglobulin A1 heavy chain

SCOPe Domain Sequences for d3m8oh2:

Sequence; same for both SEQRES and ATOM records:

>d3m8oh2 b.1.1.0 (H:119-221) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sasptspkvfplslcstqpdgnvviaclvqgffpqeplsvtwsesgqgvtarnfppsqda
sgdlyttssqltlpatqclagksvtchvkhytnpsqdvtvpcp

Timeline for d3m8oh2:

• d3m8oh2 first appeared in SCOPe 2.03
  
• d3m8oh2 appears in SCOPe 2.04
  
• d3m8oh2 appears in SCOPe 2.06
  
• d3m8oh2 appears in the current release, SCOPe 2.08