| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88575] (172 PDB entries) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) SQ NA # humanized antibody Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region SQ NA # engineered antibody including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
| Domain d1bj1h2: 1bj1 H:124-224 [21315] Other proteins in same PDB: d1bj1h1, d1bj1j1, d1bj1j2, d1bj1k1, d1bj1l1, d1bj1l2, d1bj1v_, d1bj1w_ part of humanized Fab-12 neutralizing VEGF |
PDB Entry: 1bj1 (more details), 2.4 Å
SCOP Domain Sequences for d1bj1h2:
Sequence, based on SEQRES records: (download)
>d1bj1h2 b.1.1.2 (H:124-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepk
>d1bj1h2 b.1.1.2 (H:124-224) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
svvtvpssslgtqtyicnvnhkpsntkvdkkvepk
Timeline for d1bj1h2: