Lineage for d3m8oh1 (3m8o H:1-118)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1295808Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1295809Protein automated matches [190740] (23 species)
    not a true protein
  7. 1295971Species Human (Homo sapiens) [TaxId:9606] [187920] (336 PDB entries)
  8. 1295991Domain d3m8oh1: 3m8o H:1-118 [213149]
    Other proteins in same PDB: d3m8ol2
    automated match to d1mcph1
    complexed with cl, gol

Details for d3m8oh1

PDB Entry: 3m8o (more details), 1.55 Å

PDB Description: Human IgA1 Fab fragment
PDB Compounds: (H:) Immunoglobulin A1 heavy chain

SCOPe Domain Sequences for d3m8oh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m8oh1 b.1.1.0 (H:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqlvesggglvqpggslklscaasgftlsgsnvhwvrqasgkglewvgrikrnaesdat
ayaasmrgrltisrddskntaflqmnslksddtamyycvirgdvynrqwgqgtlvtvs

SCOPe Domain Coordinates for d3m8oh1:

Click to download the PDB-style file with coordinates for d3m8oh1.
(The format of our PDB-style files is described here.)

Timeline for d3m8oh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m8oh2