Lineage for d3m84b2 (3m84 B:171-347)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584675Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
    3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold
  4. 2584676Superfamily d.139.1: PurM C-terminal domain-like [56042] (2 families) (S)
  5. 2584677Family d.139.1.1: PurM C-terminal domain-like [56043] (7 proteins)
  6. 2584678Protein Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain [56044] (2 species)
  7. 2584684Species Francisella tularensis [TaxId:177416] [225919] (1 PDB entry)
  8. 2584686Domain d3m84b2: 3m84 B:171-347 [213148]
    Other proteins in same PDB: d3m84a1, d3m84a3, d3m84b1, d3m84b3
    automated match to d1clia2
    complexed with acy, amp, fmt, so4, trs

Details for d3m84b2

PDB Entry: 3m84 (more details), 1.7 Å

PDB Description: crystal structure of phosphoribosylaminoimidazole synthetase from francisella tularensis
PDB Compounds: (B:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d3m84b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m84b2 d.139.1.1 (B:171-347) Aminoimidazole ribonucleotide synthetase (PurM) C-terminal domain {Francisella tularensis [TaxId: 177416]}
ngenikegdivfglsssglhtngysfarklffdvagnkhtdtypelegktigdvllephi
nytniihdfldngvdikgmahitgggfieniprvlpqglgaqidkdsfatpaifklmqri
gdisefemyrsfnmgigmtiiasqdqfdkmqelakkhtntklyqigkitnsgkveii

SCOPe Domain Coordinates for d3m84b2:

Click to download the PDB-style file with coordinates for d3m84b2.
(The format of our PDB-style files is described here.)

Timeline for d3m84b2: