Lineage for d3m84b1 (3m84 B:-2-170)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1657490Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 1658121Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 1658122Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 1658123Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (2 species)
  7. 1658129Species Francisella tularensis [TaxId:177416] [225918] (1 PDB entry)
  8. 1658131Domain d3m84b1: 3m84 B:-2-170 [213147]
    Other proteins in same PDB: d3m84a2, d3m84b2
    automated match to d1clia1
    complexed with acy, amp, fmt, so4, trs

Details for d3m84b1

PDB Entry: 3m84 (more details), 1.7 Å

PDB Description: crystal structure of phosphoribosylaminoimidazole synthetase from francisella tularensis
PDB Compounds: (B:) phosphoribosylformylglycinamidine cyclo-ligase

SCOPe Domain Sequences for d3m84b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m84b1 d.79.4.1 (B:-2-170) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Francisella tularensis [TaxId: 177416]}
snamaglkyedagvnieagnqavermkqhvkktftqdvltglgsfgslyslkniinnydd
pvlvqsidgvgtktkvavmcgkfenlgydlfsaatndivvmgakpitfldyvahdkldpa
imeelvkgmskacaecgvslvggetaempgvyqageidmvgvitgivdrkrii

SCOPe Domain Coordinates for d3m84b1:

Click to download the PDB-style file with coordinates for d3m84b1.
(The format of our PDB-style files is described here.)

Timeline for d3m84b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m84b2