![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) ![]() |
![]() | Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins) |
![]() | Protein Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain [55328] (3 species) |
![]() | Species Francisella tularensis [TaxId:177416] [225918] (1 PDB entry) |
![]() | Domain d3m84b1: 3m84 B:1-170 [213147] Other proteins in same PDB: d3m84a2, d3m84a3, d3m84b2, d3m84b3 automated match to d1clia1 complexed with acy, amp, fmt, so4, trs |
PDB Entry: 3m84 (more details), 1.7 Å
SCOPe Domain Sequences for d3m84b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m84b1 d.79.4.1 (B:1-170) Aminoimidazole ribonucleotide synthetase (PurM) N-terminal domain {Francisella tularensis [TaxId: 177416]} maglkyedagvnieagnqavermkqhvkktftqdvltglgsfgslyslkniinnyddpvl vqsidgvgtktkvavmcgkfenlgydlfsaatndivvmgakpitfldyvahdkldpaime elvkgmskacaecgvslvggetaempgvyqageidmvgvitgivdrkrii
Timeline for d3m84b1: