SCOP 1.73: Domain d1bj1l2: 1bj1 L:108-213

Lineage for d1bj1l2 (1bj1 L:108-213)

Root: SCOP 1.73
Class b: All beta proteins [48724] (165 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (4 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
Species Human (Homo sapiens) [TaxId:9606] [88569] (125 PDB entries)
including humanized antibodies (chimeric proteins with human constant domains)
Domain d1bj1l2: 1bj1 L:108-213 [21314]
Other proteins in same PDB: d1bj1h1, d1bj1h2, d1bj1j1, d1bj1k1, d1bj1k2, d1bj1l1, d1bj1v_, d1bj1w_

Details for d1bj1l2

PDB Entry: 1bj1 (more details), 2.4 Å

PDB Description: vascular endothelial growth factor in complex with a neutralizing antibody

PDB Compounds: (L:) fab fragment

SCOP Domain Sequences for d1bj1l2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bj1l2 b.1.1.2 (L:108-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

SCOP Domain Coordinates for d1bj1l2:

Click to download the PDB-style file with coordinates for d1bj1l2.
(The format of our PDB-style files is described here.)

Timeline for d1bj1l2: