| Root: SCOPe 2.08 |
| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.1: Actin/HSP70 [53068] (8 proteins) |
| Protein automated matches [226905] (13 species) not a true protein |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (15 PDB entries) |
| Domain d3m6gb2: 3m6g B:147-371 [213138] automated match to d1lotb2 complexed with atp, ca, lo3, mg |
PDB Entry: 3m6g (more details), 2 Å
SCOPe Domain Sequences for d3m6gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m6gb2 c.55.1.1 (B:147-371) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh
Timeline for d3m6gb2: