Lineage for d3m6ga2 (3m6g A:147-371)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1372366Family c.55.1.1: Actin/HSP70 [53068] (8 proteins)
  6. 1372729Protein automated matches [226905] (10 species)
    not a true protein
  7. 1372811Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225126] (5 PDB entries)
  8. 1372818Domain d3m6ga2: 3m6g A:147-371 [213136]
    automated match to d1lotb2
    complexed with atp, ca, lo3, mg

Details for d3m6ga2

PDB Entry: 3m6g (more details), 2 Å

PDB Description: crystal structure of actin in complex with lobophorolide
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d3m6ga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m6ga2 c.55.1.1 (A:147-371) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivh

SCOPe Domain Coordinates for d3m6ga2:

Click to download the PDB-style file with coordinates for d3m6ga2.
(The format of our PDB-style files is described here.)

Timeline for d3m6ga2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3m6ga1