Lineage for d3m6ca_ (3m6c A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850950Fold c.8: The 'swivelling' beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 2851157Superfamily c.8.5: GroEL apical domain-like [52029] (3 families) (S)
  5. 2851408Family c.8.5.0: automated matches [227259] (1 protein)
    not a true family
  6. 2851409Protein automated matches [227050] (2 species)
    not a true protein
  7. 2851414Species Mycobacterium tuberculosis [TaxId:83332] [226032] (1 PDB entry)
  8. 2851415Domain d3m6ca_: 3m6c A: [213134]
    automated match to d3osxa_

Details for d3m6ca_

PDB Entry: 3m6c (more details), 2.2 Å

PDB Description: crystal structure of mycobacterium tuberculosis groel1 apical domain
PDB Compounds: (A:) 60 kDa chaperonin 1

SCOPe Domain Sequences for d3m6ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m6ca_ c.8.5.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
eleftegigfdkgflsayfvtdfdnqqavledalillhqdkisslpdllpllekvagtgk
pllivaedvegealatlvvnairktlkavavkgpyfgdrrkafledlavvtggqvvnpda
gmvlrevglevlgsarrvvvskddtvivdgggtaeavanrakhlraeidksdsdwdrekl
gerlaklaggvavi

SCOPe Domain Coordinates for d3m6ca_:

Click to download the PDB-style file with coordinates for d3m6ca_.
(The format of our PDB-style files is described here.)

Timeline for d3m6ca_: