Lineage for d3m4vb_ (3m4v B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2004933Family a.104.1.1: Cytochrome P450 [48265] (23 protein domains)
  6. 2005432Protein automated matches [190068] (9 species)
    not a true protein
  7. 2005433Species Bacillus megaterium [TaxId:1404] [188479] (5 PDB entries)
  8. 2005437Domain d3m4vb_: 3m4v B: [213133]
    automated match to d1zoaa_
    complexed with hem; mutant

Details for d3m4vb_

PDB Entry: 3m4v (more details), 1.9 Å

PDB Description: Crystal structure of the A330P mutant of cytochrome P450 BM3
PDB Compounds: (B:) Bifunctional P-450/NADPH-P450 reductase

SCOPe Domain Sequences for d3m4vb_:

Sequence, based on SEQRES records: (download)

>d3m4vb_ a.104.1.1 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
mpqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacde
srfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiav
qlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldea
mnklqranpddpaydenkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpe
tgeplddeniryqiitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvps
ykqvkqlkyvgmvlnealrlwptappfslyakedtvlggeyplekgdelmvlipqlhrdk
tiwgddveefrperfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfe
dhtnyeldiketltlkpegfvvkakskkipl

Sequence, based on observed residues (ATOM records): (download)

>d3m4vb_ a.104.1.1 (B:) automated matches {Bacillus megaterium [TaxId: 1404]}
mpqpktfgelknlpllntdkpvqalmkiadelgeifkfeapgrvtrylssqrlikeacde
srfdknlsqalkfvrdfagdglftswtheknwkkahnillpsfsqqamkgyhammvdiav
qlvqkwerlnadehievpedmtrltldtiglcgfnyrfnsfyrdqphpfitsmvraldea
mnklkrqfqedikvmndlvdkiiadrkasgeqsddllthmlngkdpetgeplddeniryq
iitfliaghettsgllsfalyflvknphvlqkaaeeaarvlvdpvpsykqvkqlkyvgmv
lnealrlwptappfslyakedtvlggeyplekgdelmvlipqlhrdktiwgddveefrpe
rfenpsaipqhafkpfgngqracigqqfalheatlvlgmmlkhfdfedhtnyeldiketl
tlkpegfvvkakskkipl

SCOPe Domain Coordinates for d3m4vb_:

Click to download the PDB-style file with coordinates for d3m4vb_.
(The format of our PDB-style files is described here.)

Timeline for d3m4vb_: