SCOP 1.57: Domain d1beyh2: 1bey H:122-219

Lineage for d1beyh2 (1bey H:122-219)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Antibody to CAMPATH-1H humanized fab, kappa L chain [49079] (1 PDB entry)

8. Domain d1beyh2: 1bey H:122-219 [21313]
   Other proteins in same PDB: d1beyh1, d1beyl1

Details for d1beyh2

PDB Entry: 1bey, 3.25 Å

PDB Description: antibody to campath-1h humanized fab

SCOP Domain Sequences for d1beyh2:

Sequence, based on SEQRES records:

>d1beyh2 b.1.1.2 (H:122-219) Immunoglobulin (constant domains of L and H chains) {Antibody to CAMPATH-1H humanized fab, kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv

Sequence, based on observed residues (ATOM records):

>d1beyh2 b.1.1.2 (H:122-219) Immunoglobulin (constant domains of L and H chains) {Antibody to CAMPATH-1H humanized fab, kappa L chain}
astkgpsvfplapaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvpssslgtqtyicnvnhkpsntkvdkkv

Timeline for d1beyh2:

• d1beyh2 first appeared (with stable ids) in SCOP 1.55
  
• d1beyh2 appears in SCOP 1.59
  
• d1beyh2 appears in the current release, SCOPe 2.08