Lineage for d1beyh2 (1bey H:122-219)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8562Species Antibody to CAMPATH-1H humanized fab, kappa L chain [49079] (1 PDB entry)
  8. 8563Domain d1beyh2: 1bey H:122-219 [21313]
    Other proteins in same PDB: d1beyh1, d1beyl1

Details for d1beyh2

PDB Entry: 1bey (more details), 3.25 Å

PDB Description: antibody to campath-1h humanized fab

SCOP Domain Sequences for d1beyh2:

Sequence, based on SEQRES records: (download)

>d1beyh2 b.1.1.2 (H:122-219) Immunoglobulin (constant domains of L and H chains) {Antibody to CAMPATH-1H humanized fab, kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv

Sequence, based on observed residues (ATOM records): (download)

>d1beyh2 b.1.1.2 (H:122-219) Immunoglobulin (constant domains of L and H chains) {Antibody to CAMPATH-1H humanized fab, kappa L chain}
astkgpsvfplapaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvpssslgtqtyicnvnhkpsntkvdkkv

SCOP Domain Coordinates for d1beyh2:

Click to download the PDB-style file with coordinates for d1beyh2.
(The format of our PDB-style files is described here.)

Timeline for d1beyh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1beyh1