![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Antibody to CAMPATH-1H humanized fab, kappa L chain [49079] (1 PDB entry) |
![]() | Domain d1beyh2: 1bey H:122-219 [21313] Other proteins in same PDB: d1beyh1, d1beyl1 |
PDB Entry: 1bey (more details), 3.25 Å
SCOP Domain Sequences for d1beyh2:
Sequence, based on SEQRES records: (download)
>d1beyh2 b.1.1.2 (H:122-219) Immunoglobulin (constant domains of L and H chains) {Antibody to CAMPATH-1H humanized fab, kappa L chain} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv
>d1beyh2 b.1.1.2 (H:122-219) Immunoglobulin (constant domains of L and H chains) {Antibody to CAMPATH-1H humanized fab, kappa L chain} astkgpsvfplapaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv tvpssslgtqtyicnvnhkpsntkvdkkv
Timeline for d1beyh2: