Lineage for d1beyh2 (1bey H:122-219)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2022294Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)
  7. 2022298Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2022565Domain d1beyh2: 1bey H:122-219 [21313]
    Other proteins in same PDB: d1beyh1, d1beyl1, d1beyl2
    part of antibody to CAMPATH-1H humanized Fab

Details for d1beyh2

PDB Entry: 1bey (more details), 3.25 Å

PDB Description: antibody to campath-1h humanized fab
PDB Compounds: (H:) campath-1h antibody

SCOPe Domain Sequences for d1beyh2:

Sequence, based on SEQRES records: (download)

>d1beyh2 b.1.1.2 (H:122-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv

Sequence, based on observed residues (ATOM records): (download)

>d1beyh2 b.1.1.2 (H:122-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvpssslgtqtyicnvnhkpsntkvdkkv

SCOPe Domain Coordinates for d1beyh2:

Click to download the PDB-style file with coordinates for d1beyh2.
(The format of our PDB-style files is described here.)

Timeline for d1beyh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1beyh1