SCOPe 2.08: Domain d1beyh2: 1bey H:122-219

Lineage for d1beyh2 (1bey H:122-219)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d1beyh2: 1bey H:122-219 [21313]
   Other proteins in same PDB: d1beyh1, d1beyh3, d1beyl1, d1beyl2
   part of antibody to CAMPATH-1H humanized Fab

Details for d1beyh2

PDB Entry: 1bey, 3.25 Å

PDB Description: antibody to campath-1h humanized fab

PDB Compounds: (H:) campath-1h antibody

SCOPe Domain Sequences for d1beyh2:

Sequence, based on SEQRES records:

>d1beyh2 b.1.1.2 (H:122-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkv

Sequence, based on observed residues (ATOM records):

>d1beyh2 b.1.1.2 (H:122-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvpssslgtqtyicnvnhkpsntkvdkkv

Timeline for d1beyh2:

• d1beyh2 first appeared (with stable ids) in SCOP 1.55
  
• d1beyh2 appears in SCOPe 2.07