Lineage for d3m42a_ (3m42 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2588367Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
    CaMK group; MAPKAPK subfamily; serine/threonine kinase
  7. 2588368Species Human (Homo sapiens) [TaxId:9606] [82790] (16 PDB entries)
  8. 2588371Domain d3m42a_: 3m42 A: [213125]
    automated match to d1nxkc_
    complexed with hgf, mg

Details for d3m42a_

PDB Entry: 3m42 (more details), 2.68 Å

PDB Description: crystal structure of mapkap kinase 2 (mk2) complexed with a tetracyclic atp site inhibitor
PDB Compounds: (A:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d3m42a_:

Sequence, based on SEQRES records: (download)

>d3m42a_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
slgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkmlirnllk
teptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr

Sequence, based on observed residues (ATOM records): (download)

>d3m42a_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
slgvimyillcgyppfyspgmktrirmgqyefpnpewsevseevkmlirnllkteptqrm
titefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr

SCOPe Domain Coordinates for d3m42a_:

Click to download the PDB-style file with coordinates for d3m42a_.
(The format of our PDB-style files is described here.)

Timeline for d3m42a_: