SCOPe 2.08: Domain d3m2wa_: 3m2w A:

Lineage for d3m2wa_ (3m2w A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein MAP kinase activated protein kinase 2, mapkap2 [82789] (1 species)
   CaMK group; MAPKAPK subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [82790] (16 PDB entries)

8. Domain d3m2wa_: 3m2w A: [213120]
   automated match to d1nxkc_
   complexed with l8i, mg

Details for d3m2wa_

PDB Entry: 3m2w, 2.41 Å

PDB Description: crystal structure of mapkak kinase 2 (mk2) complexed with a spiroazetidine-tetracyclic atp site inhibitor

PDB Compounds: (A:) MAP kinase-activated protein kinase 2

SCOPe Domain Sequences for d3m2wa_:

Sequence, based on SEQRES records:

>d3m2wa_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
slgvimyillcgyppfysnhglaispgmktrirmgqyefpnpewsevseevkmlirnllk
teptqrmtitefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr

Sequence, based on observed residues (ATOM records):

>d3m2wa_ d.144.1.7 (A:) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]}
hvksglqikknaiiddykvtsqvlglgingkvlqifnkrtqekfalkmlqdcpkarreve
lhwrasqcphivrivdvyenlyagrkcllivmecldggelfsriqdrgdqaftereasei
mksigeaiqylhsiniahrdvkpenllytskrpnailkltdfgfakettgekydkscdmw
slgvimyillcgyppfyspgmktrirmgqyefpnpewsevseevkmlirnllkteptqrm
titefmnhpwimqstkvpqtplhtsrvlkedkerwedvkeemtsalatmr

Timeline for d3m2wa_:

• d3m2wa_ first appeared in SCOPe 2.03
  
• d3m2wa_ appears in SCOPe 2.07