| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
| Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins) fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain |
| Protein automated matches [190766] (8 species) not a true protein |
| Species Aquifex aeolicus [TaxId:63363] [226012] (1 PDB entry) |
| Domain d3m0ee_: 3m0e E: [213115] automated match to d1ny6c_ complexed with atp, mg; mutant |
PDB Entry: 3m0e (more details), 2.63 Å
SCOPe Domain Sequences for d3m0ee_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3m0ee_ c.37.1.20 (E:) automated matches {Aquifex aeolicus [TaxId: 63363]}
eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
siprdifeaelfgyekgaftgavsskegffeladggtlfldaigelsleaqakllrvies
gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
gelsclv
Timeline for d3m0ee_: