Lineage for d3m0ea_ (3m0e A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870969Family c.37.1.20: Extended AAA-ATPase domain [81269] (43 proteins)
    fold is similar to that of RecA, but lacks the last two strands, followed by a family-specific Arg-finger domain
  6. 2871357Protein automated matches [190766] (8 species)
    not a true protein
  7. 2871358Species Aquifex aeolicus [TaxId:63363] [226012] (1 PDB entry)
  8. 2871359Domain d3m0ea_: 3m0e A: [213111]
    automated match to d1ny6c_
    complexed with atp, mg; mutant

Details for d3m0ea_

PDB Entry: 3m0e (more details), 2.63 Å

PDB Description: crystal structure of the atp-bound state of walker b mutant of ntrc1 atpase domain
PDB Compounds: (A:) transcriptional regulator (NtrC family)

SCOPe Domain Sequences for d3m0ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3m0ea_ c.37.1.20 (A:) automated matches {Aquifex aeolicus [TaxId: 63363]}
eyvfespkmkeilekikkiscaecpvlitgesgvgkevvarlihklsdrskepfvalnva
siprdifeaelfgyekgaftgavsskegffeladggtlfldaigelsleaqakllrvies
gkfyrlggrkeievnvrilaatnrnikelvkegkfredlyyrlgvieieipplrerkedi
iplanhflkkfsrkyakevegftksaqelllsypwygnvrelknvieravlfsegkfidr
gelsclv

SCOPe Domain Coordinates for d3m0ea_:

Click to download the PDB-style file with coordinates for d3m0ea_.
(The format of our PDB-style files is described here.)

Timeline for d3m0ea_: