Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Human (Homo sapiens) [TaxId:9606] [88575] (63 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) |
Domain d1ce1h2: 1ce1 H:122-220 [21311] Other proteins in same PDB: d1ce1h1, d1ce1l1, d1ce1l2 part of humanized therapeutic antibody CAMPATH-1H |
PDB Entry: 1ce1 (more details), 1.9 Å
SCOP Domain Sequences for d1ce1h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ce1h2 b.1.1.2 (H:122-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens)} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve
Timeline for d1ce1h2: