Lineage for d1ce1h2 (1ce1 H:122-220)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747676Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
    Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody
  8. 2747699Domain d1ce1h2: 1ce1 H:122-220 [21311]
    Other proteins in same PDB: d1ce1h1, d1ce1h3, d1ce1l1, d1ce1l2
    part of humanized therapeutic antibody CAMPATH-1H

Details for d1ce1h2

PDB Entry: 1ce1 (more details), 1.9 Å

PDB Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen
PDB Compounds: (H:) protein (campath-1h:heavy chain)

SCOPe Domain Sequences for d1ce1h2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce1h2 b.1.1.2 (H:122-220) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkve

SCOPe Domain Coordinates for d1ce1h2:

Click to download the PDB-style file with coordinates for d1ce1h2.
(The format of our PDB-style files is described here.)

Timeline for d1ce1h2: