Class a: All alpha proteins [46456] (286 folds) |
Fold a.128: Terpenoid synthases [48575] (1 superfamily) multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers |
Superfamily a.128.1: Terpenoid synthases [48576] (6 families) duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J |
Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 proteins) automatically mapped to Pfam PF03936 |
Protein automated matches [227033] (1 species) not a true protein |
Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225866] (8 PDB entries) |
Domain d3m00a2: 3m00 A:221-548 [213106] Other proteins in same PDB: d3m00a1 automated match to d1hxga2 complexed with 2cf, mg; mutant |
PDB Entry: 3m00 (more details), 2.1 Å
SCOPe Domain Sequences for d3m00a2:
Sequence, based on SEQRES records: (download)
>d3m00a2 a.128.1.3 (A:221-548) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwtlgvyfe pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk aildlykdyekelssagrshivchaiermkeivrnynvestwfiegytppvseylsnala tttyyllattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlariievty ihnldgythpekvlkphiinllvdsiki
>d3m00a2 a.128.1.3 (A:221-548) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]} knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwtlgvyfe pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk aildlykdyekelssagrshivchaiermkeivrnynvestwfiegytppvseylsnala tttyyllattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlariievty ihnhpekvlkphiinllvdsiki
Timeline for d3m00a2: