Lineage for d3lz9a2 (3lz9 A:221-548)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010547Fold a.128: Terpenoid synthases [48575] (1 superfamily)
    multihelical; core: 8 helices (C-J) are arranged in 2 parallel layers
  4. 2010548Superfamily a.128.1: Terpenoid synthases [48576] (6 families) (S)
    duplication: two metal-binding sites are related by a pseudo dyad that also relates helices C-F to helices G-J
  5. 2010765Family a.128.1.3: Terpenoid cyclase C-terminal domain [48583] (3 protein domains)
    automatically mapped to Pfam PF03936
  6. 2010790Protein automated matches [227033] (2 species)
    not a true protein
  7. 2010791Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225866] (23 PDB entries)
  8. 2010795Domain d3lz9a2: 3lz9 A:221-548 [213104]
    Other proteins in same PDB: d3lz9a1
    automated match to d1hxga2
    complexed with fpf, mg; mutant

Details for d3lz9a2

PDB Entry: 3lz9 (more details), 2.28 Å

PDB Description: The Crystal Structure of 5-epi-aristolochene synthase M4 mutant complexed with (2-trans,6-trans)-2-fluorofarnesyl diphosphate
PDB Compounds: (A:) Aristolochene synthase

SCOPe Domain Sequences for d3lz9a2:

Sequence, based on SEQRES records: (download)

>d3lz9a2 a.128.1.3 (A:221-548) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwtlgvyfe
pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk
aildlykdyekelssagrshivchaiermkeivrnynvestwfiegytppvseylsnala
tttyyllattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat
gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlariievty
ihnldgythpekvlkphiinllvdsiki

Sequence, based on observed residues (ATOM records): (download)

>d3lz9a2 a.128.1.3 (A:221-548) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
knnvllrfakldfnllqmlhkqelaqvsrwwkdldfvttlpyardrvvecyfwtlgvyfe
pqysqarvmlvktismisivddtfdaygtvkeleaytdaiqrwdineidrlpdymkisyk
aildlykdyekelssagrshivchaiermkeivrnynvestwfiegytppvseylsnala
tttyyllattsylgmksateqdfewlsknpkileasviicrviddtatyeveksrgqiat
gieccmrdygistkeamakfqnmaetawkdinegllrptpvstefltpilnlariievty
ihnekvlkphiinllvdsiki

SCOPe Domain Coordinates for d3lz9a2:

Click to download the PDB-style file with coordinates for d3lz9a2.
(The format of our PDB-style files is described here.)

Timeline for d3lz9a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3lz9a1