SCOPe 2.08: Domain d3lz9a1: 3lz9 A:15-220

Lineage for d3lz9a1 (3lz9 A:15-220)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
   multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies

4. Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families)

5. Family a.102.4.0: automated matches [227201] (1 protein)
   not a true family

6. Protein automated matches [226931] (12 species)
   not a true protein

7. Species Tobacco (Nicotiana tabacum) [TaxId:4097] [225865] (22 PDB entries)

8. Domain d3lz9a1: 3lz9 A:15-220 [213103]
   Other proteins in same PDB: d3lz9a2
   automated match to d1hxga1
   complexed with fpf, mg; mutant

Details for d3lz9a1

PDB Entry: 3lz9, 2.28 Å

PDB Description: the crystal structure of 5-epi-aristolochene synthase m4 mutant complexed with (2-trans,6-trans)-2-fluorofarnesyl diphosphate

PDB Compounds: (A:) Aristolochene synthase

SCOPe Domain Sequences for d3lz9a1:

Sequence; same for both SEQRES and ATOM records:

>d3lz9a1 a.102.4.0 (A:15-220) automated matches {Tobacco (Nicotiana tabacum) [TaxId: 4097]}
rpvadfspslwgdqflsfsiknqvaekyakeiealkeqtrnmllatgmkladtlnlidti
erlgisyhfekeiddildqiynqnsncndlctsalqfrllrqhgfnispeifskfqdeng
kfkeslasdvlgllnlyeashvrthaddiledalafstihlesaaphlksplreqvthal
eqclhkgvprvetrffissiydkeqs

Timeline for d3lz9a1:

• d3lz9a1 first appeared in SCOPe 2.03
  
• d3lz9a1 appears in SCOPe 2.07