SCOP 1.59: Domain d1ce1l2: 1ce1 L:108-211

Lineage for d1ce1l2 (1ce1 L:108-211)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Therapeutic CAMPATH-1H humanized fab (rat), kappa L chain [49078] (1 PDB entry)

8. Domain d1ce1l2: 1ce1 L:108-211 [21310]
   Other proteins in same PDB: d1ce1h1, d1ce1l1

Details for d1ce1l2

PDB Entry: 1ce1, 1.9 Å

PDB Description: 1.9a structure of the therapeutic antibody campath-1h fab in complex with a synthetic peptide antigen

SCOP Domain Sequences for d1ce1l2:

Sequence; same for both SEQRES and ATOM records:

>d1ce1l2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Therapeutic CAMPATH-1H humanized fab (rat), kappa L chain}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d1ce1l2:

• d1ce1l2 first appeared (with stable ids) in SCOP 1.55
  
• d1ce1l2 appears in SCOP 1.57
  
• d1ce1l2 appears in SCOP 1.61
  
• d1ce1l2 appears in the current release, SCOPe 2.08